SCOPe 2.07: Domain d6lx3c2: 6lx3 C:343-464

Lineage for d6lx3c2 (6lx3 C:343-464)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6lx3c2: 6lx3 C:343-464 [386182]
   automated match to d1ow0a2

Details for d6lx3c2

PDB Entry: 6lx3, 3.15 Å

PDB Description: cryo-em structure of human secretory immunoglobulin a

PDB Compounds: (C:) Interleukin-2,Immunoglobulin heavy constant alpha 1

SCOPe Domain Sequences for d6lx3c2:

Sequence, based on SEQRES records:

>d6lx3c2 b.1.1.0 (C:343-464) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntfrpevhllpppseelalnelvtltclargfspkdvlvrwlqgsqelprekyltwasrq
epsqgtttfavtsilrvaaedwkkgdtfscmvghealplaftqktidrlagkpthvnvsv
vm

Sequence, based on observed residues (ATOM records):

>d6lx3c2 b.1.1.0 (C:343-464) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntfrpevhllpppseelalnelvtltclargfspkdvlvrwlqgsqelprekyltwasrq
epstttfavtsilrvaaedwkkgdtfscmvghealplaftqktidrlagkpthvnvsvvm

Timeline for d6lx3c2:

• d6lx3c2 is new in SCOPe 2.07-stable
  
• d6lx3c2 appears in the current release, SCOPe 2.08