SCOPe 2.07: Domain d6lk1b_: 6lk1 B:

Lineage for d6lk1b_ (6lk1 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein automated matches [190231] (13 species)
   not a true protein

7. Species Chlamydomonas reinhardtii [TaxId:3055] [385745] (3 PDB entries)

8. Domain d6lk1b_: 6lk1 B: [386150]
   automated match to d1doya_
   complexed with ben, fes, scn, so4

Details for d6lk1b_

PDB Entry: 6lk1, 0.9 Å

PDB Description: ultrahigh resolution x-ray structure of ferredoxin i from c. reinhardtii

PDB Compounds: (B:) Ferredoxin, chloroplastic

SCOPe Domain Sequences for d6lk1b_:

Sequence; same for both SEQRES and ATOM records:

>d6lk1b_ d.15.4.1 (B:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
aykvtlktpsgdktiecpadtyildaaeeagldlpyscragacsscagkvaagtvdqsdq
sflddaqmgngfvltcvayptsdctiqthqeealy

Timeline for d6lk1b_:

• d6lk1b_ is new in SCOPe 2.07-stable
  
• d6lk1b_ appears in the current release, SCOPe 2.08