Lineage for d6kyzd_ (6kyz D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2407751Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2407752Protein automated matches [190438] (33 species)
    not a true protein
  7. 2407977Species Human rhinovirus 14 [TaxId:12131] [255241] (3 PDB entries)
  8. 2407979Domain d6kyzd_: 6kyz D: [386147]
    Other proteins in same PDB: d6kyzb_, d6kyzc_, d6kyze_, d6kyzf_
    automated match to d2in2a_

Details for d6kyzd_

PDB Entry: 6kyz (more details), 1.85 Å

PDB Description: hrv14 3c in complex with single chain antibody ydf
PDB Compounds: (D:) Genome polyprotein

SCOPe Domain Sequences for d6kyzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kyzd_ b.47.1.0 (D:) automated matches {Human rhinovirus 14 [TaxId: 12131]}
falsllrknimtittskgeftglgihdrvcvipthaqpgddvlvngqkirvkdkyklvdp
eninleltvltldrnekfrdirgfisedlegvdatlvvhsnnftntilevgpvtmaglin
lsstptnrmirydyatktgqcggvlcatgkifgihvggngrqgfsaqlkkqyfvek

SCOPe Domain Coordinates for d6kyzd_:

Click to download the PDB-style file with coordinates for d6kyzd_.
(The format of our PDB-style files is described here.)

Timeline for d6kyzd_: