Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (33 species) not a true protein |
Species Human rhinovirus 14 [TaxId:12131] [255241] (3 PDB entries) |
Domain d6kyzd_: 6kyz D: [386147] Other proteins in same PDB: d6kyzb_, d6kyzc_, d6kyze_, d6kyzf_ automated match to d2in2a_ |
PDB Entry: 6kyz (more details), 1.85 Å
SCOPe Domain Sequences for d6kyzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kyzd_ b.47.1.0 (D:) automated matches {Human rhinovirus 14 [TaxId: 12131]} falsllrknimtittskgeftglgihdrvcvipthaqpgddvlvngqkirvkdkyklvdp eninleltvltldrnekfrdirgfisedlegvdatlvvhsnnftntilevgpvtmaglin lsstptnrmirydyatktgqcggvlcatgkifgihvggngrqgfsaqlkkqyfvek
Timeline for d6kyzd_: