Lineage for d6kz0l_ (6kz0 L:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355564Domain d6kz0l_: 6kz0 L: [386122]
    Other proteins in same PDB: d6kz0a1, d6kz0a2, d6kz0b_, d6kz0d1, d6kz0d2, d6kz0e_, d6kz0g1, d6kz0g2, d6kz0h_, d6kz0j1, d6kz0j2, d6kz0k_
    automated match to d1igml_

Details for d6kz0l_

PDB Entry: 6kz0 (more details), 2.4 Å

PDB Description: hrv14 3c in complex with single chain antibody ggvv
PDB Compounds: (L:) GGVV L chain

SCOPe Domain Sequences for d6kz0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kz0l_ b.1.1.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqgisnylawyqqkpgkvpklliyaastlqsgvps
rfsgsgsgtdftltisslqpedvatyycqkynsapltfgqgtkvdik

SCOPe Domain Coordinates for d6kz0l_:

Click to download the PDB-style file with coordinates for d6kz0l_.
(The format of our PDB-style files is described here.)

Timeline for d6kz0l_: