Lineage for d6shig_ (6shi G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2407751Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2407752Protein automated matches [190438] (33 species)
    not a true protein
  7. 2407799Species Human (Homo sapiens) [TaxId:9606] [187421] (92 PDB entries)
  8. 2407839Domain d6shig_: 6shi G: [385939]
    automated match to d2qxia_
    complexed with epe, pge, sh8, so4

Details for d6shig_

PDB Entry: 6shi (more details), 1.85 Å

PDB Description: human kallikrein 7 with aromatic coumarinic ester compound 2 covalently bound to h57
PDB Compounds: (G:) Kallikrein-7

SCOPe Domain Sequences for d6shig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6shig_ b.47.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkkhr

SCOPe Domain Coordinates for d6shig_:

Click to download the PDB-style file with coordinates for d6shig_.
(The format of our PDB-style files is described here.)

Timeline for d6shig_: