SCOPe 2.07: Domain d6w9dg1: 6w9d G:1-147

Lineage for d6w9dg1 (6w9d G:1-147)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.20: UBC-like [54494] (1 superfamily)
alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
Superfamily d.20.1: UBC-like [54495] (5 families)
Family d.20.1.1: UBC-related [54496] (7 proteins)
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (24 PDB entries)
Uniprot P62837
E2-17 kDa 2
Domain d6w9dg1: 6w9d G:1-147 [385933]
Other proteins in same PDB: d6w9da2, d6w9dc_, d6w9dd2, d6w9df_, d6w9dg2, d6w9di_
automated match to d5d0ma_
complexed with iod, zn

Details for d6w9dg1

PDB Entry: 6w9d (more details), 3.19 Å

PDB Description: rnf12 ring domain in complex with a ube2d2~ub conjugate

PDB Compounds: (G:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d6w9dg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w9dg1 d.20.1.1 (G:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]}
malkrihkelndlardppaqsragpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d6w9dg1:

Click to download the PDB-style file with coordinates for d6w9dg1.
(The format of our PDB-style files is described here.)

Timeline for d6w9dg1: