Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (24 PDB entries) Uniprot P62837 E2-17 kDa 2 |
Domain d6w9dg1: 6w9d G:1-147 [385933] Other proteins in same PDB: d6w9da2, d6w9dc_, d6w9dd2, d6w9df_, d6w9dg2, d6w9di_ automated match to d5d0ma_ complexed with iod, zn |
PDB Entry: 6w9d (more details), 3.19 Å
SCOPe Domain Sequences for d6w9dg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w9dg1 d.20.1.1 (G:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]} malkrihkelndlardppaqsragpvgddmfhwqatimgpndspyqggvffltihfptdy pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv peiariyktdrekynriarewtqkyam
Timeline for d6w9dg1: