SCOPe 2.07: Domain d6vmey_: 6vme Y:

Lineage for d6vmey_ (6vme Y:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (4 families)
   forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin

5. Family a.2.17.0: automated matches [385867] (1 protein)
   not a true family

6. Protein automated matches [385868] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [385869] (1 PDB entry)

8. Domain d6vmey_: 6vme Y: [385880]
   automated match to d2f66b1

Details for d6vmey_

PDB Entry: 6vme, 2.19 Å

PDB Description: human escrt-i heterotetramer headpiece

PDB Compounds: (Y:) Vacuolar protein sorting-associated protein 28 homolog

SCOPe Domain Sequences for d6vmey_:

Sequence; same for both SEQRES and ATOM records:

>d6vmey_ a.2.17.0 (Y:) automated matches {Homo sapiens [TaxId: 9606]}
elyeevklyknarerekydnmaelfavvktmqalekayikdcvspseytaacsrllvqyk
aafrqvqgseissidefcrkfrldcplamerikedrpiti

Timeline for d6vmey_:

• d6vmey_ is new in SCOPe 2.07-stable
  
• d6vmey_ appears in the current release, SCOPe 2.08