SCOPe 2.07: Domain d6prob2: 6pro B:91-202

Lineage for d6prob2 (6pro B:91-202)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [385847] (1 PDB entry)

8. Domain d6prob2: 6pro B:91-202 [385848]
   Other proteins in same PDB: d6proa1, d6prob1
   automated match to d1idsa2
   complexed with mn

Details for d6prob2

PDB Entry: 6pro, 2.26 Å

PDB Description: mnsod from geobacillus stearothermophilus

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d6prob2:

Sequence; same for both SEQRES and ATOM records:

>d6prob2 d.44.1.0 (B:91-202) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
ngggeptgeladainkkfgsftafkdefskaaagrfgsgwawlvvnngeleitstpnqds
pimegktpilgldvwehayylkyqnrrpeyiaafwnvvnwdevakryseaka

Timeline for d6prob2:

• d6prob2 is new in SCOPe 2.07-stable
  
• d6prob2 appears in the current release, SCOPe 2.08