SCOPe 2.07: Domain d6ru0c_: 6ru0 C:

Lineage for d6ru0c_ (6ru0 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold
   automatically mapped to Pfam PF00977

6. Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (4 species)

7. Species Thermotoga maritima [TaxId:2336] [51371] (9 PDB entries)

8. Domain d6ru0c_: 6ru0 C: [385835]
   Other proteins in same PDB: d6ru0b_, d6ru0d_, d6ru0f_
   automated match to d3zr4a_
   complexed with po4

Details for d6ru0c_

PDB Entry: 6ru0, 2.65 Å

PDB Description: light-regulation of imidazole glycerol phosphate synthase by interference with its allosteric machinery through photo-sensitive unnatural amino acids

PDB Compounds: (C:) Imidazole glycerol phosphate synthase subunit hisF

SCOPe Domain Sequences for d6ru0c_:

Sequence; same for both SEQRES and ATOM records:

>d6ru0c_ c.1.2.1 (C:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditafvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrlegl

Timeline for d6ru0c_:

• d6ru0c_ is new in SCOPe 2.07-stable
  
• d6ru0c_ appears in the current release, SCOPe 2.08