SCOPe 2.07: Domain d7c23b_: 7c23 B:

Lineage for d7c23b_ (7c23 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (15 species)
   not a true protein

7. Species Croceicoccus marinus [TaxId:450378] [361450] (6 PDB entries)

8. Domain d7c23b_: 7c23 B: [385758]
   automated match to d3hp4a_
   complexed with act, ca, edo, imd

Details for d7c23b_

PDB Entry: 7c23, 1.9 Å

PDB Description: crystal structure of crme10, a sgnh-hydrolase family esterase

PDB Compounds: (B:) carboxylesterase

SCOPe Domain Sequences for d7c23b_:

Sequence; same for both SEQRES and ATOM records:

>d7c23b_ c.23.10.0 (B:) automated matches {Croceicoccus marinus [TaxId: 450378]}
davmptgpaidvlafgdslfagyrldrdesyparlqaalrerglnvnvtnagvsgdttaa
glqridfvldsmagepdlvllelgandmlrglpaeearrnldtilqrldqrdipvmvygm
raapnlggdygrsfdsifpdladkydaelvpffieplifdrslvqqdqlhptaqgvdamv
eqtveqvedriddl

Timeline for d7c23b_:

• d7c23b_ is new in SCOPe 2.07-stable
  
• d7c23b_ appears in the current release, SCOPe 2.08