Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily |
Family d.58.58.0: automated matches [191564] (1 protein) not a true family |
Protein automated matches [190980] (6 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [385756] (1 PDB entry) |
Domain d6k2ea_: 6k2e A: [385757] automated match to d4tnoa_ |
PDB Entry: 6k2e (more details), 2.8 Å
SCOPe Domain Sequences for d6k2ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6k2ea_ d.58.58.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} gshmyvivvydvnvervnrvhkllktylfwrqnsvfegelskaqlyelemrlkrivkedd svliyifpgknfdlhvvgrdkspvemii
Timeline for d6k2ea_: