Lineage for d6k2ea_ (6k2e A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562976Superfamily d.58.58: CRISPR associated protein Cas2-like [143430] (2 families) (S)
    contains extra C-terminal beta-strand that integrates into the beta-sheet of the other subunit in the homodimer, a probable biological unit of this superfamily
  5. 2563002Family d.58.58.0: automated matches [191564] (1 protein)
    not a true family
  6. 2563003Protein automated matches [190980] (6 species)
    not a true protein
  7. 2563011Species Pyrococcus horikoshii [TaxId:70601] [385756] (1 PDB entry)
  8. 2563012Domain d6k2ea_: 6k2e A: [385757]
    automated match to d4tnoa_

Details for d6k2ea_

PDB Entry: 6k2e (more details), 2.8 Å

PDB Description: crystal structure of cas2
PDB Compounds: (A:) CRISPR/cas2 protein

SCOPe Domain Sequences for d6k2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k2ea_ d.58.58.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
gshmyvivvydvnvervnrvhkllktylfwrqnsvfegelskaqlyelemrlkrivkedd
svliyifpgknfdlhvvgrdkspvemii

SCOPe Domain Coordinates for d6k2ea_:

Click to download the PDB-style file with coordinates for d6k2ea_.
(The format of our PDB-style files is described here.)

Timeline for d6k2ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6k2eb_