Lineage for d6kuma_ (6kum A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2540891Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2541028Protein automated matches [190231] (13 species)
    not a true protein
  7. 2541038Species Chlamydomonas reinhardtii [TaxId:3055] [385745] (3 PDB entries)
  8. 2541041Domain d6kuma_: 6kum A: [385753]
    automated match to d1doya_
    complexed with ben, cl, fes, na, scn

Details for d6kuma_

PDB Entry: 6kum (more details), 1.4 Å

PDB Description: ferredoxin i from c. reinhardtii, low x-ray dose
PDB Compounds: (A:) Ferredoxin, chloroplastic

SCOPe Domain Sequences for d6kuma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kuma_ d.15.4.1 (A:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
aykvtlktpsgdktiecpadtyildaaeeagldlpyscragacsscagkvaagtvdqsdq
sflddaqmgngfvltcvayptsdctiqthqeeal

SCOPe Domain Coordinates for d6kuma_:

Click to download the PDB-style file with coordinates for d6kuma_.
(The format of our PDB-style files is described here.)

Timeline for d6kuma_: