Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein automated matches [190231] (13 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [385745] (3 PDB entries) |
Domain d6kuma_: 6kum A: [385753] automated match to d1doya_ complexed with ben, cl, fes, na, scn |
PDB Entry: 6kum (more details), 1.4 Å
SCOPe Domain Sequences for d6kuma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kuma_ d.15.4.1 (A:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} aykvtlktpsgdktiecpadtyildaaeeagldlpyscragacsscagkvaagtvdqsdq sflddaqmgngfvltcvayptsdctiqthqeeal
Timeline for d6kuma_: