SCOPe 2.07: Domain d6k26a_: 6k26 A:

Lineage for d6k26a_ (6k26 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein automated matches [195197] (7 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [385741] (1 PDB entry)

8. Domain d6k26a_: 6k26 A: [385742]
   automated match to d4fo7b_
   complexed with na

Details for d6k26a_

PDB Entry: 6k26, 1.85 Å

PDB Description: crystal structure of vibrio cholerae methionine aminopeptidase

PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d6k26a_:

Sequence; same for both SEQRES and ATOM records:

>d6k26a_ d.127.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
sikiknaveiekmrvagrlaaevlemiephvkagvtteeldqichkyitevqgaipapln
yhgfpksictsinhivchgipasedtyfgqiqrpavlrdgdilniditvikdgyhgdtsk
mfligdvsiedkrlchvaqeclylalkqvkpgvqlgeigttiekhiktnnknnprfkfsi
vrdycghgigaefheepqvvhyknsdrtvlregmiftiepminagkfgcrlddedswtvy
tadgkksaqwehtilvtatgceiltlrseeslprilnna

Timeline for d6k26a_:

• d6k26a_ is new in SCOPe 2.07-stable
  
• d6k26a_ appears in the current release, SCOPe 2.08