Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (3 families) Toxin component of plasmid stabilisation system |
Family d.298.1.0: automated matches [191658] (1 protein) not a true family |
Protein automated matches [191236] (7 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [385722] (1 PDB entry) |
Domain d7bwfa_: 7bwf A: [385724] Other proteins in same PDB: d7bwfb1, d7bwfb2, d7bwfd1, d7bwfd2 automated match to d2a6sb_ |
PDB Entry: 7bwf (more details), 1.7 Å
SCOPe Domain Sequences for d7bwfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7bwfa_ d.298.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} arlnitfspqafedykyfqqnnkkmvkkinellksidrngalegigkpeklksnltgyys rrinhehrlvytvddnhikiasckyhy
Timeline for d7bwfa_: