Lineage for d7bwfa_ (7bwf A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615958Fold d.298: RelE-like [143010] (1 superfamily)
    beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432
  4. 2615959Superfamily d.298.1: RelE-like [143011] (3 families) (S)
    Toxin component of plasmid stabilisation system
  5. 2615995Family d.298.1.0: automated matches [191658] (1 protein)
    not a true family
  6. 2615996Protein automated matches [191236] (7 species)
    not a true protein
  7. 2616033Species Staphylococcus aureus [TaxId:1280] [385722] (1 PDB entry)
  8. 2616034Domain d7bwfa_: 7bwf A: [385724]
    Other proteins in same PDB: d7bwfb1, d7bwfb2, d7bwfd1, d7bwfd2
    automated match to d2a6sb_

Details for d7bwfa_

PDB Entry: 7bwf (more details), 1.7 Å

PDB Description: yoeb-yefm complex from staphylococcus aureus
PDB Compounds: (A:) Addiction module antitoxin RelB

SCOPe Domain Sequences for d7bwfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7bwfa_ d.298.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
arlnitfspqafedykyfqqnnkkmvkkinellksidrngalegigkpeklksnltgyys
rrinhehrlvytvddnhikiasckyhy

SCOPe Domain Coordinates for d7bwfa_:

Click to download the PDB-style file with coordinates for d7bwfa_.
(The format of our PDB-style files is described here.)

Timeline for d7bwfa_: