SCOPe 2.07: Domain d6yvaa1: 6yva A:4-61

Lineage for d6yvaa1 (6yva A:4-61)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (33 PDB entries)

8. Domain d6yvaa1: 6yva A:4-61 [385719]
   Other proteins in same PDB: d6yvaa2
   automated match to d4m0wa1

Details for d6yvaa1

PDB Entry: 6yva, 3.18 Å

PDB Description: plpro-c111s with misg15

PDB Compounds: (A:) Replicase polyprotein 1a

SCOPe Domain Sequences for d6yvaa1:

Sequence, based on SEQRES records:

>d6yvaa1 d.15.1.0 (A:4-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
tikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpnd

Sequence, based on observed residues (ATOM records):

>d6yvaa1 d.15.1.0 (A:4-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
tikvfttvdninlhtqvvdmygqfgptyldgadvtkikphnshegktfyvlpnd

Timeline for d6yvaa1:

• d6yvaa1 is new in SCOPe 2.07-stable
  
• d6yvaa1 appears in the current release, SCOPe 2.08