SCOPe 2.07: Domain d6wqma_: 6wqm A:

Lineage for d6wqma_ (6wqm A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.2: Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD [51165] (2 proteins)
   contains extra N-terminal 3-helical domain
   this is a repeat family; one repeat unit is 6amy A:120-137 found in domain

6. Protein automated matches [191042] (5 species)
   not a true protein

7. Species Bartonella henselae [TaxId:283166] [385658] (1 PDB entry)

8. Domain d6wqma_: 6wqm A: [385711]
   automated match to d3eg4a_
   complexed with cl

Details for d6wqma_

PDB Entry: 6wqm, 2.15 Å

PDB Description: crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate n- succinyltransferase from bartonella henselae

PDB Compounds: (A:) 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase

SCOPe Domain Sequences for d6wqma_:

Sequence; same for both SEQRES and ATOM records:

>d6wqma_ b.81.1.2 (A:) automated matches {Bartonella henselae [TaxId: 283166]}
dltqlemiiekafddrnsintttkgeilesvehalnlldkgevrvvkrqkngkwhvhqwl
kkavllsfrlnpmqimtggvngtswwdkvpskfshwqeadfkkadfrsvpgaivrhsayi
apnvilmpsfvnlgafvdegtmvdtwatvgscaqigkhvhlsggvgiggvleplqanpti
iedhcfigarsevvegciiregsvlgmgvfigkstkiidrttgeifigevppysvvvpgs
lpgkplpngeigpnlycavivkrvdqktrektsindllrd

Timeline for d6wqma_:

• d6wqma_ is new in SCOPe 2.07-stable
  
• d6wqma_ appears in the current release, SCOPe 2.08