SCOPe 2.07: Domain d6wihd1: 6wih D:35-158

Lineage for d6wihd1 (6wih D:35-158)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.224: SufE/NifU [82648] (1 superfamily)
   alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123

4. Superfamily d.224.1: SufE/NifU [82649] (4 families)
   iron-sulfur cluster assembly proteins

5. Family d.224.1.2: NifU/IscU domain [102928] (5 proteins)

6. Protein automated matches [254586] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [341681] (5 PDB entries)

8. Domain d6wihd1: 6wih D:35-158 [385702]
   Other proteins in same PDB: d6wiha1, d6wiha2, d6wihc_, d6wihd2
   automated match to d2l4xa_
   complexed with 1pe, 8q1, edo, edt, gol, p15, peg, pg4, pge, plp; mutant

Details for d6wihd1

PDB Entry: 6wih, 1.9 Å

PDB Description: n-terminal mutation of iscu2 (l35h36) traps nfs1 cys loop in the active site of iscu2 without metal present. structure of human mitochondrial complex nfs1-iscu2(l35h36)-isd11 with e.coli acp1 at 1.9 a resolution (niau)2.

PDB Compounds: (D:) Iron-sulfur cluster assembly enzyme ISCU, mitochondrial

SCOPe Domain Sequences for d6wihd1:

Sequence; same for both SEQRES and ATOM records:

>d6wihd1 d.224.1.2 (D:35-158) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhtqvvdhyenprnvgsldktsknvgtglvgapacgdvmklqiqvdekgkivdarfktfg
cgsaiassslatewvkgktveealtikntdiakelclppvklhcsmlaedaikaaladyk
lkqe

Timeline for d6wihd1:

• d6wihd1 is new in SCOPe 2.07-stable
  
• d6wihd1 appears in the current release, SCOPe 2.08