Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (27 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein automated matches [190301] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187108] (5 PDB entries) |
Domain d6yvhk_: 6yvh K: [385698] automated match to d1fuka_ protein/RNA complex |
PDB Entry: 6yvh (more details), 3.19 Å
SCOPe Domain Sequences for d6yvhk_:
Sequence, based on SEQRES records: (download)
>d6yvhk_ c.37.1.19 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanftvs smhgdmpqkeresimkefrsgasrvlistdvwargldvpqvsliinydlpnnrelyihri grsgrygrkgvainfvknddirilrdieqyystqidempmnvadli
>d6yvhk_ c.37.1.19 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ltlegikqffvavereewkfdtlcdlydtltitqavifcntkrkvdwltekmreanftvs smhgdmpqkeresimkefrsgasrvlistdvwgldvpqvsliinydlpnnrelyihrigr sgrygrkgvainfvknddirilrdieqyystqidempmnvadli
Timeline for d6yvhk_: