Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) |
Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) |
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins) |
Protein Eglin C [54656] (1 species) |
Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries) |
Domain d2teci_: 2tec I: [38563] Other proteins in same PDB: d2tece_ |
PDB Entry: 2tec (more details), 1.98 Å
SCOP Domain Sequences for d2teci_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2teci_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis)} ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp hvg
Timeline for d2teci_: