SCOP 1.61: Domain d2teci_: 2tec I:

Lineage for d2teci_ (2tec I:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)

6. Protein Eglin C [54656] (1 species)

7. Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)

8. Domain d2teci_: 2tec I: [38563]
   Other proteins in same PDB: d2tece_

Details for d2teci_

PDB Entry: 2tec, 1.98 Å

PDB Description: molecular dynamics refinement of a thermitase-eglin-c complex at 1.98 angstroms resolution and comparison of two crystal forms that differ in calcium content

SCOP Domain Sequences for d2teci_:

Sequence; same for both SEQRES and ATOM records:

>d2teci_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis)}
ksfpevvgktvdqareyftlhypqydvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg

Timeline for d2teci_:

• d2teci_ first appeared (with stable ids) in SCOP 1.55
  
• d2teci_ appears in SCOP 1.59
  
• d2teci_ appears in SCOP 1.63
  
• d2teci_ appears in the current release, SCOPe 2.08