SCOPe 2.07: Domain d6u9sb1: 6u9s B:1-111

Lineage for d6u9sb1 (6u9s B:1-111)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.0: automated matches [191470] (1 protein)
not a true family
Protein automated matches [190740] (29 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
Domain d6u9sb1: 6u9s B:1-111 [385620]
Other proteins in same PDB: d6u9sb2, d6u9sc1, d6u9sc2, d6u9sc3, d6u9se2, d6u9sf1, d6u9sf2
automated match to d1dn0a1
complexed with gol

Details for d6u9sb1

PDB Entry: 6u9s (more details), 2.4 Å

PDB Description: crystal structure of human cd81 large extracellular loop in complex with 5a6 fab

PDB Compounds: (B:) 5A6 FAB Light Chain

SCOPe Domain Sequences for d6u9sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6u9sb1 b.1.1.0 (B:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqsplslpvtpgepasisckssqsllhsrtrknylawylqkpgqspqlliywastr
esgvpdrfsgsgsgtdftlkisrveaedvgvyyckqsynlyafgqgtklei

SCOPe Domain Coordinates for d6u9sb1:

Click to download the PDB-style file with coordinates for d6u9sb1.
(The format of our PDB-style files is described here.)

Timeline for d6u9sb1: