![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) |
![]() | Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) ![]() |
![]() | Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins) |
![]() | Protein Eglin C [54656] (1 species) |
![]() | Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries) |
![]() | Domain d1egp.1: 1egp A:,B: [38561] |
PDB Entry: 1egp (more details), 2 Å
SCOP Domain Sequences for d1egp.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1egp.1 d.40.1.1 (A:,B:) Eglin C {Leech (Hirudo medicinalis)} lksfpevvgktvdqareyftlhypqynvyflpegspvtlXynrvrvfynpgtnvvnhvph vg
Timeline for d1egp.1: