Lineage for d1egp.1 (1egp A:,B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily) Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family) 
Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins) Protein Eglin C [54656] (1 species) Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries) 
Domain d1egp.1: 1egp A:,B: [38561]
Details for d1egp.1
PDB Entry: 1egp (more details), 2 Å
PDB Description: proteinase inhibitor eglin c with hydrolysed reactive center
SCOP Domain Sequences for d1egp.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1egp.1 d.40.1.1 (A:,B:) Eglin C {Leech (Hirudo medicinalis)}
lksfpevvgktvdqareyftlhypqynvyflpegspvtlXynrvrvfynpgtnvvnhvph
vg
SCOP Domain Coordinates for d1egp.1:
Click to download the PDB-style file with coordinates for d1egp.1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1egp.1:
- d1egp.1 appears in SCOP 1.57
- d1egp.1 appears in the current release, SCOPe 2.08
View in 3D