PDB entry 1egp

View 1egp on RCSB PDB site
Description: proteinase inhibitor eglin c with hydrolysed reactive center
Deposited on 1995-09-01, released 1995-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.122
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1egp.1
  • Chain 'B':
    Domains in SCOP 1.55: d1egp.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egpA (A:)
    lksfpevvgktvdqareyftlhypqynvyflpegspvtl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1egpB (B:)
    ynrvrvfynpgtnvvnhvphvg