SCOP 1.55: Domain d1csei_: 1cse I:

Lineage for d1csei_ (1cse I:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.40: CI-2 family of serine protease inhibitors [54653] (1 superfamily)

4. Superfamily d.40.1: CI-2 family of serine protease inhibitors [54654] (1 family)

5. Family d.40.1.1: CI-2 family of serine protease inhibitors [54655] (4 proteins)

6. Protein Eglin C [54656] (1 species)

7. Species Leech (Hirudo medicinalis) [TaxId:6421] [54657] (11 PDB entries)

8. Domain d1csei_: 1cse I: [38559]
   Other proteins in same PDB: d1csee_

Details for d1csei_

PDB Entry: 1cse, 1.2 Å

PDB Description: the high-resolution x-ray crystal structure of the complex formed between subtilisin carlsberg and eglin c, an elastase inhibitor from the leech hirudo medicinalis. structural analysis, subtilisin structure and interface geometry

SCOP Domain Sequences for d1csei_:

Sequence; same for both SEQRES and ATOM records:

>d1csei_ d.40.1.1 (I:) Eglin C {Leech (Hirudo medicinalis)}
ksfpevvgktvdqareyftlhypqynvyflpegspvtldlrynrvrvfynpgtnvvnhvp
hvg

Timeline for d1csei_:

• d1csei_ appears in SCOP 1.57
  
• d1csei_ appears in the current release, SCOPe 2.08