Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) |
Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (2 proteins) automatically mapped to Pfam PF03740 |
Protein automated matches [190984] (2 species) not a true protein |
Species Escherichia coli [TaxId:83333] [385537] (1 PDB entry) |
Domain d6rg0b_: 6rg0 B: [385551] automated match to d1m5wa_ |
PDB Entry: 6rg0 (more details), 3.07 Å
SCOPe Domain Sequences for d6rg0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rg0b_ c.1.24.1 (B:) automated matches {Escherichia coli [TaxId: 83333]} aelllgvnidhiatlrnargtaypdpvqaafiaeqagadgitvhlredrrhitdrdvril rqtldtrmnlemavteemlaiavetkphfcclvpekrqevtteggldvagqrdkmrdack rladagiqvslfidadeeqikaaakvgapfieihtgcyadaktdaeqaqelariakaatf aaslglkvnaghgltyrnvkaiaaipemhelnighaiigravltglkvavaemkrlmlea rg
Timeline for d6rg0b_: