Lineage for d6rg0b_ (6rg0 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2449141Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) (S)
  5. 2449142Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (2 proteins)
    automatically mapped to Pfam PF03740
  6. 2449177Protein automated matches [190984] (2 species)
    not a true protein
  7. 2449178Species Escherichia coli [TaxId:83333] [385537] (1 PDB entry)
  8. 2449180Domain d6rg0b_: 6rg0 B: [385551]
    automated match to d1m5wa_

Details for d6rg0b_

PDB Entry: 6rg0 (more details), 3.07 Å

PDB Description: structure of pdxj
PDB Compounds: (B:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d6rg0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rg0b_ c.1.24.1 (B:) automated matches {Escherichia coli [TaxId: 83333]}
aelllgvnidhiatlrnargtaypdpvqaafiaeqagadgitvhlredrrhitdrdvril
rqtldtrmnlemavteemlaiavetkphfcclvpekrqevtteggldvagqrdkmrdack
rladagiqvslfidadeeqikaaakvgapfieihtgcyadaktdaeqaqelariakaatf
aaslglkvnaghgltyrnvkaiaaipemhelnighaiigravltglkvavaemkrlmlea
rg

SCOPe Domain Coordinates for d6rg0b_:

Click to download the PDB-style file with coordinates for d6rg0b_.
(The format of our PDB-style files is described here.)

Timeline for d6rg0b_: