SCOPe 2.07: Domain d6ncfc1: 6ncf C:5-114

Lineage for d6ncfc1 (6ncf C:5-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.0: automated matches [227174] (1 protein)
   not a true family

6. Protein automated matches [226891] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225245] (9 PDB entries)

8. Domain d6ncfc1: 6ncf C:5-114 [385512]
   Other proteins in same PDB: d6ncfc2, d6ncfd2
   automated match to d3o8yb1
   complexed with af7, fe2

Details for d6ncfc1

PDB Entry: 6ncf, 2.87 Å

PDB Description: the structure of stable-5-lipoxygenase bound to akba

PDB Compounds: (C:) Arachidonate 5-lipoxygenase

SCOPe Domain Sequences for d6ncfc1:

Sequence; same for both SEQRES and ATOM records:

>d6ncfc1 b.12.1.0 (C:5-114) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sytvtvatgsqehagtddyiylslvgsagcsekhlldkgsfergavdsydvtvdeelgei
qlvriekrkygsnddwylkyitlktphgdyiefpcyrwitgdvevvlrdg

Timeline for d6ncfc1:

• d6ncfc1 is new in SCOPe 2.07-stable
  
• d6ncfc1 appears in the current release, SCOPe 2.08