Lineage for d6le3f_ (6le3 F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455849Species Lentibacter algarum [TaxId:576131] [385424] (1 PDB entry)
  8. 2455851Domain d6le3f_: 6le3 F: [385449]
    automated match to d4z9xa_
    complexed with ace

Details for d6le3f_

PDB Entry: 6le3 (more details), 2.1 Å

PDB Description: crystal structure of gluconate 5-dehydrogenase from lentibacter algarum
PDB Compounds: (F:) Gluconate 5-dehydrogenase

SCOPe Domain Sequences for d6le3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6le3f_ c.2.1.0 (F:) automated matches {Lentibacter algarum [TaxId: 576131]}
lfdlsgkvacitgassglgrraaltlaaagakvvgvarradaldnlcaeigpaaaavvad
vasrdglertvadisapfgapdilvhaagvntreaaddvtfngwdqtlalnlsapfflsk
afvpemrkkgwgrivnfaslqttrafpggiaygatkggiaqltramaeawspdgitanai
gpgffpteltaavfeddaraarnaaqtcigrngtlsdmdgpilflcsdasayvtgqvlmv
dggftak

SCOPe Domain Coordinates for d6le3f_:

Click to download the PDB-style file with coordinates for d6le3f_.
(The format of our PDB-style files is described here.)

Timeline for d6le3f_: