SCOPe 2.07: Domain d6l25a1: 6l25 A:2-255

Lineage for d6l25a1 (6l25 A:2-255)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (34 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [385382] (1 PDB entry)

8. Domain d6l25a1: 6l25 A:2-255 [385406]
   Other proteins in same PDB: d6l25a2, d6l25b2
   automated match to d1yixa1
   complexed with mse, ni, po4

Details for d6l25a1

PDB Entry: 6l25, 1.85 Å

PDB Description: deoxyribonuclease from staphylococcus aureus

PDB Compounds: (A:) deoxyribonuclease ycfH

SCOPe Domain Sequences for d6l25a1:

Sequence; same for both SEQRES and ATOM records:

>d6l25a1 c.1.9.0 (A:2-255) automated matches {Staphylococcus aureus [TaxId: 1280]}
lidthvhlndeqydddlsevitrareagvdrmfvvgfnkstieramklideydflygiig
whpvdaidfteehlewieslaqhpkvigigemgldyhwdkspadvqkevfrkqialakrl
klpiiihnreatqdcidilleehaeevggimhsfsgspeiadivtnklnfyislggpvtf
knakqpkevakhvsmerllvetdapylsphpyrgkrneparvtlvaeqiaelkglsyeev
ceqttknaeklfnl

Timeline for d6l25a1:

• d6l25a1 is new in SCOPe 2.07-stable
  
• d6l25a1 appears in the current release, SCOPe 2.08