SCOP 1.55: Domain d1b3ob3: 1b3o B:178-231

Lineage for d1b3ob3 (1b3o B:178-231)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.37: CBS-domain [54630] (1 superfamily)

4. Superfamily d.37.1: CBS-domain [54631] (1 family)

5. Family d.37.1.1: CBS-domain [54632] (1 protein)

6. Protein Type II inosine monophosphate dehydrogenase [54633] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54634] (1 PDB entry)

8. Domain d1b3ob3: 1b3o B:178-231 [38539]
   Other proteins in same PDB: d1b3oa1, d1b3ob1

Details for d1b3ob3

PDB Entry: 1b3o, 2.9 Å

PDB Description: ternary complex of human type-ii inosine monophosphate dehydrogenase with 6-cl-imp and selenazole adenine dinucleotide

SCOP Domain Sequences for d1b3ob3:

Sequence; same for both SEQRES and ATOM records:

>d1b3ob3 d.37.1.1 (B:178-231) Type II inosine monophosphate dehydrogenase {Human (Homo sapiens)}
imtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknr

Timeline for d1b3ob3:

• d1b3ob3 appears in SCOP 1.57
  
• d1b3ob3 last appears in SCOP 1.73