Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.37: CBS-domain [54630] (1 superfamily) |
Superfamily d.37.1: CBS-domain [54631] (1 family) |
Family d.37.1.1: CBS-domain [54632] (1 protein) |
Protein Type II inosine monophosphate dehydrogenase [54633] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54634] (1 PDB entry) |
Domain d1b3ob3: 1b3o B:178-231 [38539] Other proteins in same PDB: d1b3oa1, d1b3ob1 |
PDB Entry: 1b3o (more details), 2.9 Å
SCOP Domain Sequences for d1b3ob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3ob3 d.37.1.1 (B:178-231) Type II inosine monophosphate dehydrogenase {Human (Homo sapiens)} imtkredlvvapagitlkeaneilqrskkgklpivneddelvaiiartdlkknr
Timeline for d1b3ob3: