Lineage for d6k1fb1 (6k1f B:5-355)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517702Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
    consists of two domains of similar topology, 3 layers (a/b/a) each
    Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
    Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134
  4. 2517703Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) (S)
  5. 2517704Family c.85.1.1: L-fucose isomerase, N-terminal and second domains [53744] (2 proteins)
  6. 2517713Protein automated matches [385328] (1 species)
    not a true protein
  7. 2517714Species Raoultella planticola [TaxId:575] [385329] (2 PDB entries)
  8. 2517716Domain d6k1fb1: 6k1f B:5-355 [385376]
    Other proteins in same PDB: d6k1fa2, d6k1fb2, d6k1fc2, d6k1fd2, d6k1fe2, d6k1ff2
    automated match to d1fuia2
    complexed with mn

Details for d6k1fb1

PDB Entry: 6k1f (more details), 2.5 Å

PDB Description: crystal structure of the l-fucose isomerase from raoultella sp.
PDB Compounds: (B:) l-fucose isomerase

SCOPe Domain Sequences for d6k1fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6k1fb1 c.85.1.1 (B:5-355) automated matches {Raoultella planticola [TaxId: 575]}
slpkigirpvidgrrmgvresleaqtmnmakataaliseklrhacgaqiecviadtciag
maesaaceekfsrqnvgvtitvtpcwcygsetidmdplrpkaiwgfngterpgavylaaa
laahsqkgipafsiyghdvqdaddttipadveekllrfaraglavasmkgksylsvggvs
mgiagsivdhnffeswlgmkvqavdmtelrrridqkiydevelemalawadknfrygedq
naqhykrdeeqsravlkesllmamcirdmmqgneklaekglveeslgynaiaagfqgqrh
wtdqypngdtaeallnssfdwngvrepfvvatendslngvamlmghqltgt

SCOPe Domain Coordinates for d6k1fb1:

Click to download the PDB-style file with coordinates for d6k1fb1.
(The format of our PDB-style files is described here.)

Timeline for d6k1fb1: