SCOPe 2.07: Domain d6yhwb_: 6yhw B:

Lineage for d6yhwb_ (6yhw B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188033] (7 PDB entries)

8. Domain d6yhwb_: 6yhw B: [385236]
   automated match to d3zl2a_
   complexed with bcd, hp6, man, ta5

Details for d6yhwb_

PDB Entry: 6yhw, 1.96 Å

PDB Description: co-crystals in the p212121 space group, of a beta-cyclodextrin spacered by triazole heptyl from alpha-d-mannose, with fimh lectin at 2.00 a resolution.

PDB Compounds: (B:) FimH

SCOPe Domain Sequences for d6yhwb_:

Sequence; same for both SEQRES and ATOM records:

>d6yhwb_ b.2.3.2 (B:) automated matches {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvptg

Timeline for d6yhwb_:

• d6yhwb_ is new in SCOPe 2.07-stable
  
• d6yhwb_ appears in the current release, SCOPe 2.08