Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.3: Extradiol dioxygenases [54602] (4 proteins) duplication: consists of 2 similar domains with 2 repeats in each Similar to the Methylmalonyl-CoA epimerase dimer |
Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species) |
Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry) |
Domain d1mpyd2: 1mpy D:146-307 [38515] complexed with acn, fe2 |
PDB Entry: 1mpy (more details), 2.8 Å
SCOPe Domain Sequences for d1mpyd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpyd2 d.32.1.3 (D:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} maavrfdhalmygdelpatydlftkvlgfylaeqvldengtrvaqflslstkahdvafih hpekgrlhhvsfhletwedllraadlismtdtsidigptrhglthgktiyffdpsgnrne vfcggdynypdhkpvtwttdqlgkaifyhdrilnerfmtvlt
Timeline for d1mpyd2: