SCOPe 2.03: Domain d1mpyd1: 1mpy D:1-145

Lineage for d1mpyd1 (1mpy D:1-145)

Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/beta
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)
Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
duplication: consists of 2 similar domains with 2 repeats in each
Similar to the Methylmalonyl-CoA epimerase dimer
Protein Catechol 2,3-dioxygenase (metapyrocatechase) [54606] (1 species)
Species Pseudomonas putida, mt2 [TaxId:303] [54607] (1 PDB entry)
Domain d1mpyd1: 1mpy D:1-145 [38514]
complexed with acn, fe2

Details for d1mpyd1

PDB Entry: 1mpy (more details), 2.8 Å

PDB Description: structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2

PDB Compounds: (D:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d1mpyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpyd1 d.32.1.3 (D:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]}
mnkgvmrpghvqlrvldmskalehyvellgliemdrddqgrvylkawtevdkfslvlrea
depgmdfmgfkvvdedalrqlerdlmaygcaveqlpagelnscgrrvrfqapsghhfely
adkeytgkwglndvnpeawprdlkg

SCOPe Domain Coordinates for d1mpyd1:

Click to download the PDB-style file with coordinates for d1mpyd1.
(The format of our PDB-style files is described here.)

Timeline for d1mpyd1: