Lineage for d6sqrb_ (6sqr B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546288Protein automated matches [190124] (13 species)
    not a true protein
  7. 2546306Species Human (Homo sapiens) [TaxId:9606] [186848] (60 PDB entries)
  8. 2546369Domain d6sqrb_: 6sqr B: [385055]
    Other proteins in same PDB: d6sqrc1, d6sqrc2, d6sqrf1, d6sqrf2, d6sqri_, d6sqrl1, d6sqrl2
    automated match to d4v3ka_
    complexed with edo, no3, zn

Details for d6sqrb_

PDB Entry: 6sqr (more details), 2.18 Å

PDB Description: crystal structure of cat mdm2-s429e ring domain bound to ubch5b-ub
PDB Compounds: (B:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d6sqrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sqrb_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkrihkelndlardppaqcragpvgddmfhwqatimgpndspyqggvffltihfptdyp
fkppkvafttriyhpninsngsikldilrsqwspaltiskvllsicsllcdpnpddplvp
eiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d6sqrb_:

Click to download the PDB-style file with coordinates for d6sqrb_.
(The format of our PDB-style files is described here.)

Timeline for d6sqrb_: