Lineage for d6jrif_ (6jri F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356783Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)
  8. 2356932Domain d6jrif_: 6jri F: [384958]
    automated match to d4grwe_

Details for d6jrif_

PDB Entry: 6jri (more details), 3.1 Å

PDB Description: crystal structure of nanobody
PDB Compounds: (F:) Nanobody

SCOPe Domain Sequences for d6jrif_:

Sequence, based on SEQRES records: (download)

>d6jrif_ b.1.1.1 (F:) automated matches {Vicugna pacos [TaxId: 30538]}
dvqlvesggglvqaggslrlsctasgftfddytmgwfrqapgkeregvsytgwsgsmsgs
ttyytdsvkgrftisrdnakntlylqmnslkpedtamyycaaaryrgigsqvrwtdfiyw
gqgtqvtvss

Sequence, based on observed residues (ATOM records): (download)

>d6jrif_ b.1.1.1 (F:) automated matches {Vicugna pacos [TaxId: 30538]}
dvqlvesggglvqaggslrlsctasgftfddytmgwfrqapgkeregvsytgwsgsttyy
tdsvkgrftisrdnakntlylqmnslkpedtamyycaaarqvrwtdfiywgqgtqvtvss

SCOPe Domain Coordinates for d6jrif_:

Click to download the PDB-style file with coordinates for d6jrif_.
(The format of our PDB-style files is described here.)

Timeline for d6jrif_: