SCOPe 2.07: Domain d6w4fa1: 6w4f A:201-396

Lineage for d6w4fa1 (6w4f A:201-396)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.5: Apolipoprotein A-I [58112] (1 superfamily)
   tetrameric antiparallel coiled coil, closed in a circuit

4. Superfamily h.5.1: Apolipoprotein A-I [58113] (1 family)

5. Family h.5.1.1: Apolipoprotein A-I [58114] (2 proteins)

6. Protein automated matches [383905] (1 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [383906] (2 PDB entries)

8. Domain d6w4fa1: 6w4f A:201-396 [384882]
   Other proteins in same PDB: d6w4fa2
   automated match to d1av1a_
   complexed with 17f, gdp, mg, pcw

Details for d6w4fa1

PDB Entry: 6w4f

PDB Description: nmr-driven structure of kras4b-gdp homodimer on a lipid bilayer nanodisc

PDB Compounds: (A:) apolipoprotein a-I

SCOPe Domain Sequences for d6w4fa1:

Sequence; same for both SEQRES and ATOM records:

>d6w4fa1 h.5.1.1 (A:201-396) automated matches {Homo sapiens [TaxId: 9606]}
lklldnwdsvtstfsklreqlgpvtqefwdnleketeglrqemskdleevkakvqpyldd
fqkkwqeemelyrqkveplraelqegarqklhelqeklsplgeemrdrarahvdalrthl
apysdelrqrlaarlealkenggarlaeyhakatehlstlsekakpaledlrqgllpvle
sfkvsflsaleeytkk

Timeline for d6w4fa1:

• d6w4fa1 is new in SCOPe 2.07-stable
  
• d6w4fa1 appears in the current release, SCOPe 2.08