SCOPe 2.07: Domain d6vj7b1: 6vj7 B:8-120

Lineage for d6vj7b1 (6vj7 B:8-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.0: automated matches [227279] (1 protein)
   not a true family

6. Protein automated matches [227090] (1 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (12 PDB entries)

8. Domain d6vj7b1: 6vj7 B:8-120 [384857]
   Other proteins in same PDB: d6vj7a2, d6vj7b2, d6vj7c2, d6vj7d2
   automated match to d1kbpa1
   complexed with anp, bma, edo, fe, fuc, gol, ipa, na, nag, pg4, pge, so4, zn

Details for d6vj7b1

PDB Entry: 6vj7, 2.6 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with adenosine 5'-(beta,gamma imido)triphosphate

PDB Compounds: (B:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6vj7b1:

Sequence; same for both SEQRES and ATOM records:

>d6vj7b1 b.1.12.0 (B:8-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d6vj7b1:

• d6vj7b1 is new in SCOPe 2.07-stable
  
• d6vj7b1 appears in the current release, SCOPe 2.08