SCOPe 2.07: Domain d6py9a1: 6py9 A:8-120

Lineage for d6py9a1 (6py9 A:8-120)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families)

5. Family b.1.12.0: automated matches [227279] (1 protein)
   not a true family

6. Protein automated matches [227090] (1 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [226471] (12 PDB entries)

8. Domain d6py9a1: 6py9 A:8-120 [384730]
   Other proteins in same PDB: d6py9a2, d6py9b2, d6py9c2, d6py9d2
   automated match to d1kbpa1
   complexed with act, ad9, edo, fe, flc, fuc, gol, ipa, na, nag, p4j, pge, so4, zn

Details for d6py9a1

PDB Entry: 6py9, 2.2 Å

PDB Description: crystal structure of red kidney bean purple acid phosphatase in complex with adenosine diphosphate metavanadate

PDB Compounds: (A:) Fe(3+)-Zn(2+) purple acid phosphatase

SCOPe Domain Sequences for d6py9a1:

Sequence; same for both SEQRES and ATOM records:

>d6py9a1 b.1.12.0 (A:8-120) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
nrdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrk
riakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

Timeline for d6py9a1:

• d6py9a1 is new in SCOPe 2.07-stable
  
• d6py9a1 appears in the current release, SCOPe 2.08