Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (70 species) not a true protein |
Species Hymenobacter sp. [TaxId:1484118] [384659] (1 PDB entry) |
Domain d6lvpc_: 6lvp C: [384660] automated match to d2qq3c_ |
PDB Entry: 6lvp (more details), 2.69 Å
SCOPe Domain Sequences for d6lvpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lvpc_ c.14.1.0 (C:) automated matches {Hymenobacter sp. [TaxId: 1484118]} matsfdnllydldaatgvltltvnrpaklnalnaatiaeldtaaqqaladpavrailltg sgekafvagadiaelasltavqaagasaygqrvfaqferspkpvvaavngfalgggcela machlrvaadtarfglpevslgllpgyggtqrlpqlvgkakalelmltadmikadealrl glvnhvvplaellgfcqqllakmlskgpvalglviecvnagydprqdgyvaeteafgraf qtddfkegtqafvekrpavfqgk
Timeline for d6lvpc_: