Lineage for d6lvpc_ (6lvp C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462064Species Hymenobacter sp. [TaxId:1484118] [384659] (1 PDB entry)
  8. 2462067Domain d6lvpc_: 6lvp C: [384660]
    automated match to d2qq3c_

Details for d6lvpc_

PDB Entry: 6lvp (more details), 2.69 Å

PDB Description: enoyl-coa hydratase (hyech) from hymenobacter sp. pamc 26628
PDB Compounds: (C:) enoyl-coa hydratase

SCOPe Domain Sequences for d6lvpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lvpc_ c.14.1.0 (C:) automated matches {Hymenobacter sp. [TaxId: 1484118]}
matsfdnllydldaatgvltltvnrpaklnalnaatiaeldtaaqqaladpavrailltg
sgekafvagadiaelasltavqaagasaygqrvfaqferspkpvvaavngfalgggcela
machlrvaadtarfglpevslgllpgyggtqrlpqlvgkakalelmltadmikadealrl
glvnhvvplaellgfcqqllakmlskgpvalglviecvnagydprqdgyvaeteafgraf
qtddfkegtqafvekrpavfqgk

SCOPe Domain Coordinates for d6lvpc_:

Click to download the PDB-style file with coordinates for d6lvpc_.
(The format of our PDB-style files is described here.)

Timeline for d6lvpc_: