Lineage for d6v5pd_ (6v5p D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2587580Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2587581Species Human (Homo sapiens) [TaxId:9606] [82796] (129 PDB entries)
    Uniprot P00533 702-1018
  8. 2587701Domain d6v5pd_: 6v5p D: [384594]
    automated match to d4zseb_
    complexed with cl, qp4

Details for d6v5pd_

PDB Entry: 6v5p (more details), 2.3 Å

PDB Description: egfr(t790m/v948r) in complex with ln2725
PDB Compounds: (D:) Epidermal growth factor receptor

SCOPe Domain Sequences for d6v5pd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6v5pd_ d.144.1.7 (D:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
qallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankeil
deayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqyllnwcvq
iakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpikw
malesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppict
idvymimrkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyra
lmdeedmd

SCOPe Domain Coordinates for d6v5pd_:

Click to download the PDB-style file with coordinates for d6v5pd_.
(The format of our PDB-style files is described here.)

Timeline for d6v5pd_: