SCOPe 2.07: Domain d6xw5d1: 6xw5 D:6-115

Lineage for d6xw5d1 (6xw5 D:6-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)

8. Domain d6xw5d1: 6xw5 D:6-115 [384546]
   Other proteins in same PDB: d6xw5c2, d6xw5c3, d6xw5d2, d6xw5d3
   automated match to d5da4a_
   complexed with edo, trs

Details for d6xw5d1

PDB Entry: 6xw5, 1.72 Å

PDB Description: crystal structure of murine norovirus p domain in complex with nanobody nb-5820

PDB Compounds: (D:) Nanobody NB-5820

SCOPe Domain Sequences for d6xw5d1:

Sequence; same for both SEQRES and ATOM records:

>d6xw5d1 b.1.1.1 (D:6-115) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqaggslrlscaasgrtfslttmgwfrqapgedrafvtsisraaytyyadsvkg
rftisrdnaknmvslqmnslkpedtavyvcagkgqggtwdywgqgtqvtv

Timeline for d6xw5d1:

• d6xw5d1 is new in SCOPe 2.07-stable
  
• d6xw5d1 appears in the current release, SCOPe 2.08