SCOP 1.75: Domain d1hr0p_: 1hr0 P:

Lineage for d1hr0p_ (1hr0 P:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
   beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
   Uniprot P80379

8. Domain d1hr0p_: 1hr0 P: [38446]
   Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
   complexed with mg, zn

Details for d1hr0p_

PDB Entry: 1hr0, 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

PDB Compounds: (P:) 30S ribosomal protein S16

SCOP Domain Sequences for d1hr0p_:

Sequence; same for both SEQRES and ATOM records:

>d1hr0p_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

Timeline for d1hr0p_:

• d1hr0p_ first appeared (with stable ids) in SCOP 1.55
  
• d1hr0p_ appears in SCOP 1.73
  
• d1hr0p_ appears in SCOPe 2.01
  
• d1hr0p_ appears in the current release, SCOPe 2.08