Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.14: Histone demethylase core [254153] (4 proteins) Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801 |
Protein automated matches [254635] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255633] (301 PDB entries) |
Domain d5rb6a1: 5rb6 A:1380-1717 [384379] Other proteins in same PDB: d5rb6a2, d5rb6b2 automated match to d4c8da_ complexed with cl, mn, s9v |
PDB Entry: 5rb6 (more details), 1.63 Å
SCOPe Domain Sequences for d5rb6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5rb6a1 b.82.2.14 (A:1380-1717) automated matches {Human (Homo sapiens) [TaxId: 9606]} tshswlcdgrllclhdpsnknnwkifrecwkqgqpvlvsgvhkklkselwkpeafsqefg dqdvdlvncrncaiisdvkvrdfwdgfeiickrlrsedgqpmvlklkdwppgedfrdmmp trfedlmenlplpeytkrdgrlnlasrlpsyfvrpdlgpkmynayglitaedrrvgttnl hldvsdavnvmvyvgipigegahdeevlktidegdadevtkerihdhkekpgalwhiyaa kdaekirellrkvgeeqgqenppdhdpihdqswyldqtlrkrlyeeygvqgwaivqflgd avfipagaphqvhnlyscikvaedfvspehvkhcfrlt
Timeline for d5rb6a1: