SCOPe 2.07: Domain d5rb6a1: 5rb6 A:1380-1717

Lineage for d5rb6a1 (5rb6 A:1380-1717)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Histone demethylase core [254153] (4 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801

6. Protein automated matches [254635] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255633] (301 PDB entries)

8. Domain d5rb6a1: 5rb6 A:1380-1717 [384379]
   Other proteins in same PDB: d5rb6a2, d5rb6b2
   automated match to d4c8da_
   complexed with cl, mn, s9v

Details for d5rb6a1

PDB Entry: 5rb6, 1.63 Å

PDB Description: pandda analysis group deposition -- crystal structure of jmjd1b in complex with fm001569a

PDB Compounds: (A:) lysine-specific demethylase 3b

SCOPe Domain Sequences for d5rb6a1:

Sequence; same for both SEQRES and ATOM records:

>d5rb6a1 b.82.2.14 (A:1380-1717) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tshswlcdgrllclhdpsnknnwkifrecwkqgqpvlvsgvhkklkselwkpeafsqefg
dqdvdlvncrncaiisdvkvrdfwdgfeiickrlrsedgqpmvlklkdwppgedfrdmmp
trfedlmenlplpeytkrdgrlnlasrlpsyfvrpdlgpkmynayglitaedrrvgttnl
hldvsdavnvmvyvgipigegahdeevlktidegdadevtkerihdhkekpgalwhiyaa
kdaekirellrkvgeeqgqenppdhdpihdqswyldqtlrkrlyeeygvqgwaivqflgd
avfipagaphqvhnlyscikvaedfvspehvkhcfrlt

Timeline for d5rb6a1:

• d5rb6a1 is new in SCOPe 2.07-stable
  
• d5rb6a1 appears in the current release, SCOPe 2.08