Lineage for d3eipb_ (3eip B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies) 
Superfamily d.26.2: Colicin E3 immunity protein [54552] (1 family) 
Family d.26.2.1: Colicin E3 immunity protein [54553] (1 protein) Protein Colicin E3 immunity protein [54554] (1 species) Species Escherichia coli [TaxId:562] [54555] (1 PDB entry) 
Domain d3eipb_: 3eip B: [38435]
Details for d3eipb_
PDB Entry: 3eip (more details), 1.8 Å
PDB Description: crystal structure of colicin e3 immunity protein: an inhibitor to a ribosome-inactivating rnase
SCOP Domain Sequences for d3eipb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eipb_ d.26.2.1 (B:) Colicin E3 immunity protein {Escherichia coli}
glkldltwfdkstedfkgeeyskdfgddgsvmeslgvpfkdnvnngcfdviaewvpllqp
yfnhqidisdneyfvsfdyrdgdw
SCOP Domain Coordinates for d3eipb_:
Click to download the PDB-style file with coordinates for d3eipb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3eipb_:
- d3eipb_ appears in SCOP 1.57
- d3eipb_ appears in the current release, SCOPe 2.08
View in 3D
