Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein automated matches [190766] (7 species) not a true protein |
Species Escherichia coli [TaxId:83333] [384333] (3 PDB entries) |
Domain d6uqob1: 6uqo B:169-436 [384336] Other proteins in same PDB: d6uqog_, d6uqoh_, d6uqoi_, d6uqoj_, d6uqok_, d6uqol_, d6uqom_, d6uqon_, d6uqoo_, d6uqop_, d6uqoq_, d6uqor_, d6uqos_, d6uqot_ automated match to d1r6bx2 complexed with adp, ags |
PDB Entry: 6uqo (more details), 3.1 Å
SCOPe Domain Sequences for d6uqob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uqob1 c.37.1.20 (B:169-436) automated matches {Escherichia coli [TaxId: 83333]} menfttnlnqlarvggidpligrekeleraiqvlcrrrknnpllvgesgvgktaiaegla wrivqgdvpevmadctiysldigsllagtkyrgdfekrfkallkqleqdtnsilfideih tiigagaasggqvdaanlikpllssgkirvigsttyqefsnifekdralarrfqkidite psieetvqiinglkpkyeahhdvrytakavraavelavkyindrhlpdkaidvideagar arlmpvskrkktvnvadiesvvariari
Timeline for d6uqob1: