Lineage for d6tvpb1 (6tvp B:1-387)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518443Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2518444Protein automated matches [190965] (39 species)
    not a true protein
  7. 2518557Species Mycolicibacterium smegmatis [TaxId:246196] [384328] (1 PDB entry)
  8. 2518559Domain d6tvpb1: 6tvp B:1-387 [384329]
    Other proteins in same PDB: d6tvpa2, d6tvpb2
    automated match to d3c4va_
    complexed with na

Details for d6tvpb1

PDB Entry: 6tvp (more details), 1.9 Å

PDB Description: structure of mycobacterium smegmatis alpha-maltose-1-phosphate synthase glgm
PDB Compounds: (B:) Alpha-maltose-1-phosphate synthase

SCOPe Domain Sequences for d6tvpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tvpb1 c.87.1.0 (B:1-387) automated matches {Mycolicibacterium smegmatis [TaxId: 246196]}
mrvammtreyppevyggagvhvtelvaqlrklcdvdvhcmgaprdgayvahpdptlrgan
aaltmlsadlnmvnnaeaatvvhshtwytglaghlasllygvphvltahsleplrpwkae
qlgggyqvsswvertaveaadaviavssgmrddvlrtypaldpdrvhvvrngidttvwyp
aepgpdesvlaelgvdlnrpivafvgritrqkgvahlvaaahrfapdvqlvlcagapdtp
qiaeevssavqqlaqartgvfwvremlpthkireilsaatvfvcpsvyeplgivnleama
catavvasdvggipevvadgrtgllvhydandteayearlaeavnslvadpdrareygva
grercieefswahiaeqtleiyrkvsa

SCOPe Domain Coordinates for d6tvpb1:

Click to download the PDB-style file with coordinates for d6tvpb1.
(The format of our PDB-style files is described here.)

Timeline for d6tvpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6tvpb2