Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Bradyrhizobium sp. [TaxId:566679] [384270] (9 PDB entries) |
Domain d6thfa2: 6thf A:155-341 [384292] Other proteins in same PDB: d6thfa3 automated match to d1bq5a2 complexed with cu, mes, so4 |
PDB Entry: 6thf (more details), 1.47 Å
SCOPe Domain Sequences for d6thfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6thfa2 b.6.1.0 (A:155-341) automated matches {Bradyrhizobium sp. [TaxId: 566679]} dglndghghslrydriyyigeqdlyvprdekgnfksydspgeaysdteevmrkltpthvv fngkagaltgknalnanvgenvlivhsqanrdsrphligghgdyvwetgkfsnapetgle twfirggsagaalykflqpgiyayvthnlieaanlgatahfkvegkwnddlmtqvkapad iptgstn
Timeline for d6thfa2: