SCOPe 2.07: Domain d6omgc2: 6omg C:116-204

Lineage for d6omgc2 (6omg C:116-204)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d6omgc2: 6omg C:116-204 [384232]
   Other proteins in same PDB: d6omga1, d6omga2, d6omgb_, d6omgc1, d6omgd1, d6omgd2
   automated match to d2pyfa2
   complexed with fuc, gol, mvv, na, nag

Details for d6omgc2

PDB Entry: 6omg, 2.1 Å

PDB Description: structure of mouse cd1d- glc-dag (sn-1 c18:0, sn-2 c18:1c9)-inkt tcr ternary complex

PDB Compounds: (C:) chimeric t cell antigen receptor alpha chain va14,va24

SCOPe Domain Sequences for d6omgc2:

Sequence, based on SEQRES records:

>d6omgc2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d6omgc2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnfacanafnnsiipedtffps

Timeline for d6omgc2:

• d6omgc2 is new in SCOPe 2.07-stable
  
• d6omgc2 appears in the current release, SCOPe 2.08