Lineage for d1fkra_ (1fkr A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548411Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 2548415Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)
  8. 2548471Domain d1fkra_: 1fkr A: [38422]

Details for d1fkra_

PDB Entry: 1fkr (more details)

PDB Description: solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin
PDB Compounds: (A:) fk506 and rapamycin-binding protein

SCOPe Domain Sequences for d1fkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkra_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d1fkra_:

Click to download the PDB-style file with coordinates for d1fkra_.
(The format of our PDB-style files is described here.)

Timeline for d1fkra_: