Lineage for d5r8ma_ (5r8m A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401515Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2401543Protein Interleukin-1beta [50363] (2 species)
  7. 2401544Species Human (Homo sapiens) [TaxId:9606] [50364] (53 PDB entries)
    Uniprot P01584 117-269
  8. 2401549Domain d5r8ma_: 5r8m A: [384177]
    automated match to d9ilba_
    complexed with s8g, so4

Details for d5r8ma_

PDB Entry: 5r8m (more details), 1.39 Å

PDB Description: pandda analysis group deposition interleukin-1 beta -- fragment z1818332938 in complex with interleukin-1 beta
PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d5r8ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5r8ma_ b.42.1.2 (A:) Interleukin-1beta {Human (Homo sapiens) [TaxId: 9606]}
apvrslnctlrdsqqkslvmsgpyelkalhlqgqdmeqqvvfsmsfvqgeesndkipval
glkeknlylscvlkddkptlqlesvdpknypkkkmekrfvfnkieinnklefesaqfpnw
yistsqaenmpvflggtkggqditdftmqfvs

SCOPe Domain Coordinates for d5r8ma_:

Click to download the PDB-style file with coordinates for d5r8ma_.
(The format of our PDB-style files is described here.)

Timeline for d5r8ma_: