Lineage for d6ke9c_ (6ke9 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2311421Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2312022Protein automated matches [193445] (8 species)
    not a true protein
  7. 2312123Species Human (Homo sapiens) [TaxId:9606] [193446] (77 PDB entries)
  8. 2312242Domain d6ke9c_: 6ke9 C: [384093]
    Other proteins in same PDB: d6ke9b_, d6ke9d_, d6ke9f_, d6ke9h_
    automated match to d5jrgg_
    protein/DNA complex; complexed with mn

Details for d6ke9c_

PDB Entry: 6ke9 (more details), 2.22 Å

PDB Description: the human telomeric nucleosome displays distinct structural and dynamic properties
PDB Compounds: (C:) Histone H2A type 1-B/E

SCOPe Domain Sequences for d6ke9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ke9c_ a.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnkk
triiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk

SCOPe Domain Coordinates for d6ke9c_:

Click to download the PDB-style file with coordinates for d6ke9c_.
(The format of our PDB-style files is described here.)

Timeline for d6ke9c_: